APC Rabbit anti-Mouse CD59a monoclonal antibody

Size

POA

SKU:: A28360
Additional Names:: Cd59|MAC-IP|MACIF
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LTCYHCFQPVVSSCNMNSTCSPDQDSCLYAVAGMQVYQRCWKQSDCHGEIIMDQLEETKLKFRCCQFNLCNKS
Uniprot:: O55186
Synonyms:: AA987121;Cd59;CD59 antigen;CD59A glycoprotein;MAC-inhibitory protein;MAC-IP;MACIF;membrane attack complex inhibition factor;prot;protectin
Extra Details:: Predicted to enable complement binding activity. Involved in several processes, including negative regulation of angiogenesis; negative regulation of fibroblast growth factor production; and negative regulation of vascular endothelial growth factor receptor signaling pathway. Acts upstream of or within negative regulation of activation of membrane attack complex. Located in external side of plasma membrane. Is expressed in several structures, including Meckel's cartilage; nervous system; neural retina; skeleton; and testis. Human ortholog(s) of this gene implicated in colorectal carcinoma and ovarian cancer. Orthologous to human CD59 (CD59 molecule (CD59 blood group)).