PE Rabbit anti-Rat CD25 monoclonal antibody

Size

POA

SKU:: A28355
Additional Names:: IL2RAC
Application:: Flow Cytometry
Species Reactivity:: Rat
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Species:: Rat
Sequence:: ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLNELVYMACLGNSWSNNCQCTSNSHDNSREQVTPQPEGQKEQQTTDTQKSTQSVYQENLAGHCREPPPWRHEDTKRIYHFVEGQIVLYTCIQGYKALQRGPAISICKTVCGEIRWTHPQLTCVDEKEHHQFLASEESQGSRNSFPESEASCPTPNTDFSQLTEATTTMETFVFTKEYQ
Uniprot:: P26897
Synonyms:: CD25;IDDM10;IL-2 receptor alpha subunit;IL-2 receptor subunit alpha;IL-2-RA;IL-2R subunit alpha;IL2-RA;IL2R;IL2RAC;IMD41;interleukin 2 receptor, alpha;interleukin 2 receptor, alpha chain;interleukin-2 receptor subunit alpha;p55;TAC antigen;TCGFR
Extra Details:: CD25, also known as the interleukin-2 receptor alpha chain (IL-2RA Alpha). It is widely expressed on activated T and B cells in rats, subsets of thymic and splenic dendritic cells, as well as on intestinal epithelial cells. IL-2 is a key cytokine involved in lymphocyte proliferation and clonal expansion. Signaling through IL-2 requires the high-affinity IL-2 receptor, which is composed of the A Alpha (CD25), B Beta (CD122), and G Gamma (CD132) chains.