PE Rabbit anti-Mouse CD70 monoclonal antibody

Size

POA

SKU:: A28353
Additional Names:: Cd27l|CD27LG|Tnfsf7|Tnlg8a
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: QQQRLLEHPEPHTAELQLNLTVPRKDPTLRWGAGPALGRSFTHGPELEEGHLRIHQDGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPAAHGISLLRGRFGQDCTVALQRLTYLVHGDVLCTNLTLPLLPSRNADETFFGVQWICP
Uniprot:: O55237
Synonyms:: CD27 ligand;CD27-L;CD27L;CD27LG;CD70 antigen;Ki-24 antigen;LPFS3;surface antigen CD70;Tnfs;TNFSF7;TNLG8A;tumor necrosis factor ligand 8A;tumor necrosis factor ligand superfamily member 7
Extra Details:: CD70 is a type II transmembrane glycoprotein and a member of the tumor necrosis factor ligand superfamily (TNFSF), also known as CD27L and TNFSF7. It is constitutively expressed on medullary thymic epithelial cells. Its expression can be induced on activated lymphocytes (B cells, T cells, and NK cells) and dendritic cells. CD70 serves as the ligand for CD27, a co-stimulatory receptor that plays a critical role in T cell activation and proliferation. Overexpression of CD70 has been reported in various malignancies, such as renal cell carcinoma, glioblastoma, and non-small cell lung carcinoma, and it is being actively pursued as a therapeutic target.