[KO Validated] G3BP Rabbit monoclonal antibody

Size

POA

SKU:: A28342
Additional Names:: G3BP|HDH-VIII
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 68 kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: IQEEKPEPVLEETAPEDAQKSSSPAPADIAQTVQEDLRTFSWASVTSKNLPPSGAVPVTGIPPHVVKVPASQPRPESKPESQIPPQRPQRDQRVREQRINIPPQRGPRPIREAG
Uniprot:: Q13283
Synonyms:: ATP-dependent DNA helicase VIII;DNA helicase VIII;G3BP;G3BP-1;GAP binding protein;GAP SH3 domain-binding protein 1;GTPase activating protein (SH3 domain) binding protein 1;HDH-VIII;ras GTPase-activating protein-binding protein 1;Ras-GTPase-activating protein SH3-domain-binding protein;RasGAP-associated endoribonuclease G3BP
Extra Details:: This gene encodes one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear RNA-binding proteins and is also an element of the Ras signal transduction pathway. It binds specifically to the Ras-GTPase-activating protein by associating with its SH3 domain. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Shipping Conditions:: Blue Ice