A28341
COL2A1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A28341
- Additional Names:
- Col2|Col2a|Col2a-1|Del1|Dmm|Lpk|M100413|Rgsc413|Rgsc856
- Application:
- ELISA, WB
- Molecular Weight:
- 36 kda
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- VPRKNWWSSKSKEKKHIWFGETMNGGFHFSYGDGNLAPNTANVQMTFLRLLSTEGSQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEMRAEGNSRFTYTALKDGCTKHTGKWGKTVIEYRSQKTSRLPIIDIAPMDIGGAEQEFGVDIGPVCFL
- Uniprot:
- P28481
- Synonyms:
- alpha-1 type II collagen;ANFH;AOM;arthroophthalmopathy, progressive (Stickler syndrome);cartilage collagen;chondrocalcin;Co;COL11A3;Col2;Col2a;Col2a-1;collagen alpha-1(II) chain;collagen II, alpha-1 polypeptide;collagen, type II, alpha 1;Del;Del1;Dmm;L;Lpk;M100413;procollagen, type II, alpha 1;Rgsc4;Rgsc413;Rgsc8;Rgsc856;SEDC;STL1
- Extra Details:
- This gene encodes the alpha-1 subunit of the fibril-forming type II collagen, the major component of cartilage and the vitreous humor of the eye. The encoded preproprotein forms homotrimeric, triple helical procollagen that undergoes proteolytic processing during fibirl formation. Mice harboring certain mutations in this gene exhibit severe chondrodysplasia characterized by short limbs and trunch, craniofacial deformities and cleft palate. A complete lack of the encoded protein in mice results in postnatal lethality. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar proteolytic processing.
- Shipping Conditions:
- Blue Ice