A28337
Granzyme B Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A28337
- Additional Names:
- CCP-1/C11|CCP1|Ctla-1|Ctla1|GZB
- Application:
- ELISA, WB
- Molecular Weight:
- 30 kDa
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- VCYVAGWGRMAPMGKYSNTLQEVELTVQKDRECESYFKNRYNKTNQICAGDPKTKRASFRGDSGGPLVCKKVAAGIVSYGYKDGSPPRAFTKVSSFLSWI
- Uniprot:
- P04187
- Synonyms:
- AI553453;C11;cathepsin G-like 1;CCP;CCP-1/C1;CCP-1/C11;CCP1;CCPI;CGL-1;CGL1;CSP-B;CSPB;Ctl;Ctla;Ctla-1;CTLA1;CTSGL1;cytotoxic cell protease 1;cytotoxic serine protease B;cytotoxic T-lymphocyte proteinase 2;fragmentin 2;fragmentin-2;granzyme B;granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1);granzyme B(G,H);GZB;HLP;human lymphocyte protein;SECT;T-cell serine protease 1-3E
- Extra Details:
- This gene encodes a member of the granzyme subfamily of proteins, part of the peptidase S1 family of serine proteases. The encoded preproprotein is secreted by natural killer (NK) cells and cytotoxic T lymphocytes (CTLs) and proteolytically processed to generate the active protease, which induces target cell apoptosis. This protein also processes cytokines and degrades extracellular matrix proteins, and these roles are implicated in chronic inflammation and wound healing. Mice lacking a functional copy of this gene exhibit impaired immune cell-mediated cytolysis.
- Shipping Conditions:
- Blue Ice