[KO Validated] SHMT2 Rabbit monoclonal antibody

Size

POA

SKU:: A28324
Additional Names:: GLYA|HEL-S-51e|mSHMT|NEDCASB|SHMT
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 56 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEVKSKTAKLQDFKSFLLKDSETSQRLANLRQRVEQFARAFPMPGFDEH
Uniprot:: P34897
Synonyms:: epididymis secretory sperm binding protein Li 51e;GLY A+;GLYA;glycine auxotroph A, human complement for hamster;glycine hydroxymethyltransferase;HEL-S-51e;NEDCASB;serine aldolase;serine hydroxymethylase;serine hydroxymethyltransferase 2 (mitochondrial);serine hydroxymethyltransferase, mitochondrial;serine methylase;SHMT;threonine aldolase
Extra Details:: This gene encodes the mitochondrial form of a pyridoxal phosphate-dependent enzyme that catalyzes the reversible reaction of serine and tetrahydrofolate to glycine and 5,10-methylene tetrahydrofolate. The encoded product is primarily responsible for glycine synthesis. The activity of the encoded protein has been suggested to be the primary source of intracellular glycine. The gene which encodes the cytosolic form of this enzyme is located on chromosome 17. Alternative splicing results in multiple transcript variants.