A28293
Nav1.5/SCN5A Rabbit monoclonal antibody
Size
POA
- SKU:
- A28293
- Additional Names:
- CDCD2|CMD1E|CMPD2|HB1|HB2|HBBD|HH1|ICCD|IVF|LQT3|Nav1.5|PFHB1|SSS1|VF1
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 250 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MGNLRHKCVRNFTALNGTNGSVEADGLVWESLDLYLSDPENYLLKNGTSDVLLCGNSSDAGTCPEGYRCLKAGENPDHGYTSFDS
- Uniprot:
- Q14524
- Synonyms:
- cardiac tetrodotoxin-insensitive voltage-dependent sodium channel alpha subunit;CDCD2;CMD1E;CMPD2;HB1;HB2;HBBD;HH1;ICCD;IVF;LQT3;Nav1.5;PFHB1;sodium channel protein cardiac muscle subunit alpha;sodium channel protein type 5 subunit alpha;Sodium channel protein type V subunit alpha;sodium channel, voltage-gated, type V, alpha subunit;SSS1;VF1;voltage-gated sodium channel subunit alpha Nav1.5
- Extra Details:
- The protein encoded by this gene is an integral membrane protein and tetrodotoxin-resistant voltage-gated sodium channel subunit. This protein is found primarily in cardiac muscle and is responsible for the initial upstroke of the action potential in an electrocardiogram. Defects in this gene have been associated with long QT syndrome type 3 (LQT3), atrial fibrillation, cardiomyopathy, and Brugada syndrome 1, all autosomal dominant cardiac diseases. Alternative splicing results in several transcript variants encoding different isoforms.
- Shipping Conditions:
- Blue Ice