NADPH oxidase 4 (NOX4) Rabbit polyclonal antibody

Size

£152.00

SKU:: A28280
Additional Names:: KOX|KOX-1|RENOX
Application:: ELISA, WB
Molecular Weight:: 67 kda
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: KPVTIISVINHPSDVMELRMIKENFKARPGQYIILHCPSVSALENHPFTLTMCPTETKATFGVHFKVVGDWTERFRDLLLPPSSQDSEILPFIHSRNYPKLYIDGPFGSPFEESLNYE
Uniprot:: Q9JHI8
Synonyms:: AI648021;kidney oxidase-1;kidney superoxide-producing NADPH oxidase;KOX;KOX-1;NADPH oxidase 4;renal NAD(P)H-oxidase;RENOX;superoxide-generating NADPH oxidase 4
Extra Details:: This gene encodes a member of the NOX-family of enzymes that functions as the catalytic subunit the NADPH oxidase complex. The encoded protein is localized to non-phagocytic cells where it acts as an oxygen sensor and catalyzes the reduction of molecular oxygen to various reactive oxygen species (ROS). The ROS generated by this protein have been implicated in numerous biological functions including signal transduction, cell differentiation and tumor cell growth. A pseudogene has been identified on the other arm of chromosome 11. Alternative splicing results in multiple transcript variants.