A28276
CAMP Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A28276
- Additional Names:
- CAP-18|CAP18|CRAMP|FALL-39|FALL39|HSD26|LL37
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 16 kDa/18 kDa
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SVRFRVKETVCGKAERQLPEQCAFKEQGVVKQCMGAVTLNPAADSFDISCNEPGAQPFRFKKISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE
- Uniprot:
- P51437
- Synonyms:
- 18 kDa cationic antimicrobial protein;C;CAP;CAP-18;CAP18;cathelicidin antimicrobial peptide;cathelin-like protein;cathelin-related antimicrobial peptide;CLP;Cnlp;Cr;CRAMP;epididymis secretory sperm binding protein;FAL;FALL-39;FALL39;HSD26;LL37;MC;MCLP
- Extra Details:
- This gene encodes a member of an antimicrobial peptide family, characterized by a highly conserved N-terminal signal peptide containing a cathelin domain and a structurally variable cationic antimicrobial peptide, which is produced by extracellular proteolysis from the C-terminus. The protein plays an important role in innate immunity defense against viruses. In addition to its antibacterial, antifungal, and antiviral activities, the encoded protein functions in cell chemotaxis, immune mediator induction, and inflammatory response regulation.
- Shipping Conditions:
- Blue Ice



