[KD Validated] PER1 Rabbit monoclonal antibody

Size

POA

SKU:: A28260
Additional Names:: hPER|PER|RIGUI
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 150 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: HITSEYTLQNQDTFSVAVSFLTGRIVYISEQAAVLLRCKRDVFRGTRFSELLAPQDVGVFYGSTAPSRL
Uniprot:: O15534
Synonyms:: circadian clock protein PERIOD 1;circadian pacemaker protein RIGUI;hPER;hPER1;PER;period circadian clock 1;period circadian protein homolog 1;period homolog 1;Period, drosophila, homolog of;RIGUI
Extra Details:: This gene is a member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. This gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene may increase the risk of getting certain cancers. Alternative splicing has been observed in this gene; however, these variants have not been fully described.