[KO Validated] GSDME (Full Length+N terminal) Rabbit monoclonal antibody

Size

POA

SKU:: A28230
Additional Names:: DFNA5|ICERE-1
Application:: ELISA, WB, IHC-P, IP
Molecular Weight:: 35 kDa/55 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ENKKRIDSVYLDPLVFREFAFIDMPDAAHGISSQDGPLSVLKQATLLLERNFHPFAELPEPQQTALSDIFQAVLFDDELLMVLEPVCDDLVSGLSPTVAV
Uniprot:: O60443
Synonyms:: DFNA5;DFNA5, deafness associated tumor suppressor;gasdermin-E;ICERE-1;inversely correlated with estrogen receptor expression 1;non-syndromic hearing impairment protein 5;nonsyndromic hearing impairment protein
Extra Details:: Hearing impairment is a heterogeneous condition with over 40 loci described. The protein encoded by this gene is expressed in fetal cochlea, however, its function is not known. Nonsyndromic hearing impairment is associated with a mutation in this gene. Three transcript variants encoding two different isoforms have been found for this gene.