A28229
Podoplanin Rabbit monoclonal antibody
Size
POA
- SKU:
- A28229
- Additional Names:
- E11|Gp38|OTS-8|RANDAM-2|T1-alpha|T1a|T1alpha
- Application:
- ELISA, WB, IHC-P, IF
- Molecular Weight:
- 36 kda
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- QGGTIGVNEDDIVTPGTGDGMVPPGIEDKITTTGATGGLNESTGKAPLVPTQRERGTKPPLEELSTSATSDHDHREHESTTTVKVVTSHSVDKKTSHPNRDNAGDETQTTDKK
- Uniprot:
- Q62011
- Synonyms:
- AGGRUS;E11;glycoprotein 36;glycoprotein 38;glycoprotein, 36-KD;Gp3;GP36;Gp38;GP40;HT1A-1;hT1alpha-1;hT1alpha-2;lung type I cell membrane associated glycoprotein;lung type-I cell membrane-associated glycoprotein (T1A-2);OTS;OTS-8;OTS8;PA2.;PA2.26;PA2.26 antigen;podoplanin;RAND;RANDAM-2;T1;T1-alpha;T1A;T1A-2;T1A2;T1alpha;TI1A;transmembrane glycoprotein E11
- Extra Details:
- Predicted to enable chemokine binding activity; protein-folding chaperone binding activity; and signaling receptor binding activity. Involved in several processes, including lymph node development; lymphatic endothelial cell fate commitment; and positive regulation of platelet aggregation. Acts upstream of or within several processes, including lung alveolus development; lymphangiogenesis; and prostaglandin metabolic process. Located in several cellular components, including external side of plasma membrane; lamellipodium; and ruffle. Is expressed in several structures, including brain; cardiovascular system; genitourinary system; hemolymphoid system; and respiratory system. Orthologous to human PDPN (podoplanin).
- Shipping Conditions:
- Blue Ice