PE Rabbit anti-Mouse T-bet/Tbx21 monoclonal antibody

Size

POA

SKU:: A28217
Additional Names:: Tbet|Tblym|TBT1
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: KGFRENFESMYASVDTSVPSPPGPNCQLLGGDPFSPLLSNQYPVPSRFYPDLPGQPKDMISQPYWLGTPREHSYEAEFRAVSMKPTLLPSAPGPTVPYYRGQDVLAPGAGWPVAPQYPPKMSPAGWFRPMRTLPMDPGLGSSEEQGSSPSLWPEVTSLQPEPSDSGLGEGDTKRRRISPYPSSGDSSSPAGAPSPFDKETEGQFYNYFPN
Uniprot:: Q9JKD8
Synonyms:: T-bet;T-box 21;T-box expressed in T cells;T-box protein 21;T-box transcription factor TBX21;T-cell-specific T-box transcription factor T-bet;T-PET;TBET;Tbly;TBLYM;TBT1;transcription factor TBLYM
Extra Details:: Enables DNA binding activity and DNA-binding transcription activator activity, RNA polymerase II-specific. Involved in several processes, including T-helper 1 cell lineage commitment; negative regulation of T-helper 17 cell lineage commitment; and regulation of gene expression. Acts upstream of or within T cell differentiation and positive regulation of isotype switching to IgG isotypes. Located in neuronal cell body and nucleus. Is expressed in several structures, including central nervous system; colon; genitourinary system; sensory organ; and thymus. Used to study asthma. Human ortholog(s) of this gene implicated in asthma, nasal polyps, and aspirin intolerance and immunodeficiency 88. Orthologous to human TBX21 (T-box transcription factor 21).

Shipping Conditions:: Blue Ice