Gata3 Rabbit PolymAb[R]

Size

POA

SKU:: A28206PM
Additional Names:: Gata-3|jal
Application:: ChIP, ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 48 kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: VLNGQHPDTHHPGLGHSYMEAQYPLTEEVDVLFNIDGQGNHVPSYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALSSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSSLAAGHSSPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVQLPDSMKLETSHSRGSMTTLGGASSSAHHPITTYPPYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSST
Uniprot:: P23772
Synonyms:: Gata;Gata-3;GATA-binding factor 3;HDR;HDRS;j;jal;trans-acting T-cell-specific transcription factor GATA-3
Extra Details:: GATA-3 is a transcription factor belonging to the GATA family, which binds to the consensus DNA sequence (A/T)GATA(A/G), controlling various tissue-specific programs of gene expression and morphogenesis. It is widely expressed in tissues derived from the mesoderm and endoderm. GATA-3 has been proven to be an essential regulatory factor for immune cell function, the development of sympathetic neurons, and the maintenance of the differentiation state of epithelial cells.