[KD Validated] LDHA Rabbit monoclonal antibody

Size

POA

SKU:: A28205
Additional Names:: GSD11|HEL-S-133P|LDHM|PIG19
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 37 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Uniprot:: P00338
Synonyms:: cell proliferation-inducing gene 19 protein;epididymis secretory sperm binding protein Li 133P;GSD11;HEL-S-133P;L-lactate dehydrogenase A chain;lactate dehydrogenase M;LDH muscle subunit;LDH-A;LDH-M;LDHM;PIG19;proliferation-inducing gene 19;renal carcinoma antigen NY-REN-59
Extra Details:: The protein encoded by this gene catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. Multiple transcript variants encoding different isoforms have been found for this gene. The human genome contains several non-transcribed pseudogenes of this gene.

Shipping Conditions:: Blue Ice