PE Rabbit anti-Mouse CD235a/Glycophorin A monoclonal antibody

Size

POA

SKU:: A28200
Additional Names:: CD235a|GPA
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MTESTAAVTTSGHSLTTTFHIPSSQHYQEEHSPSLSGSDSLLQITTPVVASTVGNPNQHSATMSTPAIHVSTYHTAPTEVSAAFEEQPVSPHIGGMPSPIQHDFPALV
Uniprot:: P14220
Synonyms:: AI853584;CD235;CD235a;erythroid-lineage-specific membrane sialoglycoprotein;G;glycophorin A (MN blood group);glycophorin A, GPA;glycophorin Erik;glycophorin MiI;glycophorin MiV;glycophorin SAT;glycophorin Sta type C;glycophorin-A;GPA;GPErik;GPSAT;HGpMiV;HGpMiXI;HGpSta(C);Mi.V glycoprotein (24 AA);MN;MN sialoglycoprotein;MNS;PAS-2;recombinant glycophorin A-B Miltenberger-DR;sialoglycoprotein alpha
Extra Details:: Enables identical protein binding activity. Acts upstream of or within regulation of response to osmotic stress. Located in external side of plasma membrane. Is expressed in liver and yolk sac. Human ortholog(s) of this gene implicated in malaria. Orthologous to several human genes including GYPA (glycophorin A (MNS blood group)).