RhoB Rabbit polyclonal antibody

Size

£152.00

SKU:: A2819
Additional Names:: ARH6|ARHB|MST081|MSTP081|RhoB|RHOH6
Application:: ELISA, WB
Molecular Weight:: 21kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: VPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCI
Uniprot:: P62745
Synonyms:: Aplysia RAS-related homolog 6;ARH6;ARHB;h6;MST081;MSTP081;oncogene RHO H6;ras homolog gene family, member B;rho cDNA clone 6;rho-related GTP-binding protein RhoB;RHOH6
Extra Details:: Predicted to enable GTP binding activity; GTPase activity; and protein kinase binding activity. Involved in several processes, including cellular response to hydrogen peroxide; cellular response to ionizing radiation; and regulation of cell migration. Located in cleavage furrow and endosome membrane. Biomarker of breast cancer.