[KO Validated] TIFA Rabbit monoclonal antibody

Size

POA

SKU:: A28185
Additional Names:: T2bp
Application:: ELISA, WB, IHC-P
Molecular Weight:: 21 kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MSTFEDADTEETVTCLQMTIYHPGQQSGIFKSIRFCSKEKFPSIEVVKFGRNSNMCQYTFQDKQVSRIQFVLQPFKQFNSSVLSFEIKNMSKKTSLMVDNQELGYLNKMDLPYKCMLRFGEYQFLLQKEDGESVESFETQFIMSSRPLLQENNWPTQNPIPEDGMYSSYFTHRSSPSEMDENEL
Uniprot:: Q793I8
Synonyms:: putative MAPK-activating protein PM14;putative NF-kappa-B-activating protein 20;T2b;T2BP;T6BP;TIFAA;TRAF-interacting protein with a forkhead-associated domain;TRAF-interacting protein with FHA domain-containing protein A;TRAF2 binding protein;TRAF2-binding protein;TRAF6 binding protein
Extra Details:: This gene encodes an adapter protein involved in adaptive and innate immunity. This protein includes a forkhead-associated (FHA) domain that specifically binds to phosphorylated serine and threonine residues. In response to bacterial infection, the encoded host cell protein undergoes an intermolecular interaction between the FHA domain and a phosphorylated threonine that leads to protein oligomerization and stimulation of the NF-kappa B and other downstream signaling pathways. This protein exhibits reduced expression in hepatocellular carcinoma and may suppress hepatocellular carcinoma progression. This protein may also play a role in the DNA damage response.

Shipping Conditions:: Blue Ice