PE Rabbit anti-Mouse IL-17F monoclonal antibody

Size

POA

SKU:: A28170
Additional Names:: IL-17F
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MKCTRETAMVKSLLLLMLGLAILREVAARKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA
Uniprot:: Q7TNI7
Synonyms:: C87042;CANDF6;cytokine ML-1;IL-17F;interleukin-17F;ML-1;ML1
Extra Details:: Enables cytokine receptor binding activity; protein heterodimerization activity; and protein homodimerization activity. Involved in defense response to bacterium and positive regulation of gene expression. Acts upstream of or within positive regulation of cytokine production involved in inflammatory response and positive regulation of transcription by RNA polymerase II. Located in extracellular space. Human ortholog(s) of this gene implicated in chronic mucocutaneous candidiasis. Orthologous to human IL17F (interleukin 17F).