PE Rabbit anti-Chicken CD25 monoclonal antibody

Size

POA

SKU:: A28169
Additional Names:: CD25|IDDM10|Il2r|IMD41|Ly-43|p55|TCGFR
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: DKCPRLSTTEFADVAAETYPLKTKLRYECDSGYRRRSGNTLTIRCQNVSGTASWVHDELVCIDEKFLFSRNHTAKLNPTQQPARQTQSPAPPKQANNSSFCGMPQTVPHASLSVHQIYSVGQVLHFKCPTGYNKQLPTTGTITCKNVDGRIKWTPADRPCTNDSGPINKQ
Uniprot:: Q90WJ4
Synonyms:: CD25;IDDM10;IL-2 alpha receptor;IL-2 receptor subunit alpha;IL-2R subunit alpha;IL2 receptor alpha;IL2R;IMD41;interleukin 2 receptor, alpha;interleukin-2 alpha receptor;interleukin-2 receptor subunit alpha;p55;TAC antigen;TCGFR
Extra Details:: CD25 is the A Alpha chain of the heterotrimeric IL-2 receptor and is highly expressed in many types of hematologic malignancies but shows low expression in most solid tumors. CD25 is also abundantly expressed on activated circulating immune cells and regulatory T cells (Tregs). The infiltration of Tregs into the tumor microenvironment can lead to an imbalance in the ratio of effector T cells (Teffs) to Tregs, which is associated with tumor progression. Restoring a balanced Teff/Treg ratio may enhance the efficacy of immunotherapy. As a potential target for Treg depletion, CD25 plays a critical role in the development of novel immunotherapeutic strategies.

Shipping Conditions:: Blue Ice