PE Rabbit anti-Mouse CD122/IL-2RB Beta monoclonal antibody

Size

POA

SKU:: A28145
Additional Names:: CD122|IL-15Rbeta|Il-2/15Rbeta|Il-2Rbeta|IL15Rbeta|p70
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPA
Uniprot:: P16297
Synonyms:: CD122;CD122 antigen;high affinity IL-2 receptor beta subunit;high affinity IL-2 receptor subunit beta;IL-15 receptor beta chain;IL-15R;IL-15Rbeta;IL-2 receptor beta chain;IL-2 receptor subunit beta;IL-2/15 receptor-beta;Il-2/15Rbeta;Il-2R;IL-2R subunit beta;IL-2RB;Il-2Rbeta;IL15R;IL15RB;IL15Rbeta;IMD63;interleukin 15 receptor, beta;interleukin 2 receptor, beta;interleukin-15 receptor subunit beta;interleukin-2 receptor subunit beta;p70;P70-75;p75
Extra Details:: The interleukin 2 receptor is composed of alpha and beta subunits. The beta subunit encoded by this gene is very homologous to the human beta subunit and also shows structural similarity to other cytokine receptors.