MTCO2 Rabbit monoclonal antibody

Size

POA

SKU:: A28143
Additional Names:: COX2
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 21-25 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: GHQWYWSYEYTDYEDLCFDSYMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLNQATVTSNRPGLFYGQCSEIC
Uniprot:: P00403
Synonyms:: COII;Cytochrome c oxidase polypeptide II;cytochrome c oxidase subunit II;MTCO2
Extra Details:: Predicted to enable copper ion binding activity and oxidoreductase activity. Predicted to contribute to cytochrome-c oxidase activity. Predicted to be involved in ATP synthesis coupled electron transport; positive regulation of cellular biosynthetic process; and positive regulation of necrotic cell death. Located in mitochondrion. Is expressed in embryo; epiblast; heart; liver; and metanephros. Orthologous to several human genes including MTCO2P12 (MT-CO2 pseudogene 12).