A2814
GPT Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A2814
- Additional Names:
- AAT1|ALT|ALT1|GPT|GPT1|SGPT
- Application:
- ELISA, WB
- Molecular Weight:
- 55kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MASSTGDRSQAVRHGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFLRQVLALCVNPDLLSSPNFPDDAKKRAERILQACGGHSLGAYSVSSGIQLIREDVARYIERRDGGIPADPNNVFLSTGASDAIVTVLKLLVAGEGHTRTGVLIPIPQYP
- Uniprot:
- P24298
- Synonyms:
- AAT1;alanine aminotransferase;alanine aminotransferase 1;alanine transaminase;ALT1;glutamate pyruvate transaminase 1;Glutamic--alanine transaminase 1;glutamic--pyruvic transaminase 1;glutamic-alanine transaminase 1;glutamic-pyruvate transaminase (alanine aminotransferase);GPT1
- Extra Details:
- This gene encodes cytosolic alanine aminotransaminase 1 (ALT1); also known as glutamate-pyruvate transaminase 1. This enzyme catalyzes the reversible transamination between alanine and 2-oxoglutarate to generate pyruvate and glutamate and, therefore, plays a key role in the intermediary metabolism of glucose and amino acids. Serum activity levels of this enzyme are routinely used as a biomarker of liver injury caused by drug toxicity, infection, alcohol, and steatosis. A related gene on chromosome 16 encodes a putative mitochondrial alanine aminotransaminase.
- Shipping Conditions:
- Blue Ice