ABflo[R] 647 Rabbit anti-Mouse CD84 monoclonal antibody

Size

POA

SKU:: A28104
Additional Names:: A130013D22Rik|CDw84|SLAMF5
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: KDADPMVMNGILGESVTFLLNIQEPKKIDNIAWTSQSSVAFIKPGVNKAEVTITQGTYKGRIEIIDQKYDLVIRDLRMEDAGTYKADINEENEETITKIYYLHIYRRLKTPKITQSLISSLNNTCNITLTCSVEKEEKDVTYSWSPFGEKSNVLQIVHSPMDQKLTYTCTAQNPVSNSSDSVTVQQPCTDTPSFHPRHAV
Uniprot:: Q18PI6
Synonyms:: A130013D22Rik;CD84 antigen (leukocyte antigen);CDw84;cell surface antigen MAX.3;hCD84;hly9-beta;leucocyte differentiation antigen CD84;leukocyte antigen CD84;leukocyte differentiation antigen CD84;LY9B;mCD84;signaling lymphocytic activation molecule 5;SLA;SLAM family member 5;SLAMF5
Extra Details:: Predicted to enable identical protein binding activity. Involved in regulation of gene expression; regulation of macrophage activation; and regulation of signal transduction. Predicted to be located in plasma membrane. Predicted to be active in external side of plasma membrane. Is expressed in brain; embryo; and testis. Orthologous to human CD84 (CD84 molecule).