A28098
RASGRP1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A28098
- Additional Names:
- calDAG-GEFII|Rasgrp
- Application:
- ELISA, WB, IP
- Molecular Weight:
- 90kDa/86kDa
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- FPWVGGETTPGHFVLSSPRKSAQGALYVHSPASPCPSPALVRKRAFVKWENKESLIKPKPELHLRLRTYQELEQEINTLKADNDALKIQLKYAQKKIESLQLGKSNHVLAQMDHGDSA
- Uniprot:
- Q9Z1S3
- Synonyms:
- calcium and DAG-regulated guanine nucleotide exchange factor II;calcium- and diacylglycerol-regulated guanine nucleotide exchange factor II;CALDAG-GEFI;CALDAG-GEFII;guanine nucleotide exchange factor, calcium- and DAG-regulated, Rap1A;IMD64;ras activator RasGRP;RAS guanyl nucleotide-releasing protein 1;RAS guanyl releasing protein 1 (calcium and DAG-regulated);Ras guanyl-releasing protein;RAS guanyl-releasing protein 1;RASGRP
- Extra Details:
- Predicted to enable several functions, including cation binding activity; diacylglycerol binding activity; and guanyl-nucleotide exchange factor activity. Involved in activation of GTPase activity; positive regulation of T cell differentiation in thymus; and positive regulation of natural killer cell differentiation. Acts upstream of or within several processes, including mast cell degranulation; regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction; and vesicle transport along microtubule. Predicted to be located in Golgi apparatus and cytosol. Predicted to be active in plasma membrane. Is expressed in several structures, including brain and olfactory epithelium. Used to study systemic lupus erythematosus. Human ortholog(s) of this gene implicated in immunodeficiency 64. Orthologous to human RASGRP1 (RAS guanyl releasing protein 1).
- Shipping Conditions:
- Blue Ice




