CLEC4E Rabbit polyclonal antibody

Size

£152.00

SKU:: A28097
Additional Names:: Clecsf9|Mincle
Application:: ELISA, WB
Molecular Weight:: 25kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: TQEEQEFLFRTKPKRKEFYIGLTDQVVEGQWQWVDDTPFTESLSFWDAGEPNNIVLVEDCATIRDSSNSRKNWNDIPCFYS
Uniprot:: Q9R0Q8
Synonyms:: C-type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 9;C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 9;C-type lectin domain family 4 member E;C-type lectin superfamily member 9;C-type lectin, superfamily member 9;C86253;Clecs;CLECSF9;macrophage-inducible C-type lectin;Min;MINCLE
Extra Details:: Enables glycolipid binding activity and pattern recognition receptor activity. Involved in antifungal innate immune response and positive regulation of cytokine production. Acts upstream of or within Fc-gamma receptor signaling pathway; T cell differentiation involved in immune response; and defense response to bacterium. Is active in phagocytic vesicle membrane and plasma membrane. Orthologous to human CLEC4E (C-type lectin domain family 4 member E).