PE Rabbit anti-Human CD32 monoclonal antibody

Size

POA

SKU:: A28015
Additional Names:: CD32|CD32A|CDw32|FCG2|FcgammaRIIa|FcGR|FCGR2|FCGR2A1|IGFR2
Application:: Flow Cytometry
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: AAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGI
Uniprot:: P12318
Synonyms:: CD32;CD32A;CDw32;Fc fragment of IgG, low affinity IIa, receptor (CD32);Fc gamma receptor RIIa3;Fc-gamma RII-a;fc-gamma-RIIa;FCG2;FcGR;FCGR2;FCGR2A1;fcRII-a;IGFR2;igG Fc receptor II-a;Immunoglobulin G Fc receptor II;low affinity immunoglobulin gamma Fc region receptor II-a
Extra Details:: This gene encodes one member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Alternative splicing results in multiple transcript variants.