LRG1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A28008
Additional Names:: 1300008B03Rik|2310031E04Rik|A2GL|Lrg|lrhg
Application:: ELISA, WB, IHC-P
Molecular Weight:: 38kda
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SLKECLILQSAEGSTVSCHGPTEFPSSLPADTVHLSVEFSNLTQLPAAALQGCPGLRELHLSSNRLQALSPELLAPVPRLRALDLTRNALRSLPPGLFSTSANLSTLVLRENQLREVSAQWLQGLDALGHLDLAENQLSSLPSGLLASLGALHTLDLGYNLLESLPEGLLRGPRRLQRLHLEGNRLQRLEDSLLAPQPFLRVLFLNDNQLVGVATGSFQGLQHLDMLDLSNNSLSSTPPGLWAFLGRPTRDMQDGFDISHNPWICDKNLADLCRWLVANRNKMFSQNDTRCAGPEAMKGQRLLDVAELGSL
Uniprot:: Q91XL1
Synonyms:: 1300008B03Rik;2310031E04Rik;HMFT1766;leucine rich alpha 2 glycoprotein;leucine-rich alpha-2-glycoprotein;Lr;Lrg;Lrhg
Extra Details:: Enables transforming growth factor beta receptor binding activity. Acts upstream of or within several processes, including brown fat cell differentiation; positive regulation of endothelial cell proliferation; and positive regulation of transforming growth factor beta receptor signaling pathway. Located in extracellular space. Is expressed in pancreas mesenchyme. Orthologous to human LRG1 (leucine rich alpha-2-glycoprotein 1).