RNASE2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A28007
Additional Names:: mR4|Rnase2|RNS2
Application:: ELISA, WB, IHC-P, IF
Molecular Weight:: 18kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: QAQILSQKFYTQHIYNSTYPRCDAVMRVVNRYRPRCKDINTFLHTSFADVVAVCGHPNITCNNLTRKNCHASSFQVFITFCNLTMPTRICTQCRYQTTGSVKYYRVACENRTPQDTPMYPVVPVHLDGTF
Uniprot:: O35291
Synonyms:: EDN;eosinophil cationic-type ribonuclease 4;eosinophil-derived neurotoxin;liver, eosinophil-derived neurotoxin;mR;MR-4;mR4;murine ribonuclease 4;non-secretory ribonuclease;RAF3;ribonuclease 2;ribonuclease A F3;ribonuclease US;ribonuclease, RNase A family, 2;ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin);RNase 2;RNase UpI-2;Rnase2;RNS2
Extra Details:: Predicted to enable RNA nuclease activity and lipopolysaccharide binding activity. Predicted to be involved in chemotaxis; defense response to Gram-positive bacterium; and innate immune response in mucosa. Predicted to be located in lysosome. Predicted to be active in extracellular space. Orthologous to human RNASE2 (ribonuclease A family member 2) and RNASE3 (ribonuclease A family member 3).