ALDH3A1 Rabbit monoclonal antibody

Size

POA

SKU:: A27998
Additional Names:: Ahd-c|AHDC|Aldh|Aldh3|Aldh3a1
Application:: ELISA, WB, IHC-P, IF
Molecular Weight:: 60kDa
Species Reactivity:: Rat
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Species:: Rat
Sequence:: MSSISDTVKRAREAFNSGKTRSLQFRIQQLEALQRMINENLKSISGALASDLGKNEWTSYYEEVAHVLEELDTTIKELPDWAEDEPVAKTRQTQQDDLYIHSE
Uniprot:: P11883
Synonyms:: Ahd-c;AHDC;Aldehyde dehydrogenase (Ahd-c);aldehyde dehydrogenase 3A1;aldehyde dehydrogenase class 3;aldehyde dehydrogenase family 3 member A1;aldehyde dehydrogenase family 3 subfamily A1;aldehyde dehydrogenase isozyme 3;aldehyde dehydrogenase type III;aldehyde dehydrogenase, dimeric NADP-preferring;Aldh;ALDH3;ALDHIII;HTC-ALDH;stomach aldehyde dehydrogenase;Tumor-associated aldehyde dehydrogenase;tumor-associated aldehyde dehydrogenase tumor ALDH
Extra Details:: Enables 3-chloroallyl aldehyde dehydrogenase activity. Involved in several processes, including response to cAMP; response to glucocorticoid; and response to hypoxia. Located in cytosol. Human ortholog(s) of this gene implicated in arteriosclerosis. Orthologous to human ALDH3A1 (aldehyde dehydrogenase 3 family member A1).