A2793
SHP2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A2793
- Additional Names:
- BPTP3|CFC|JMML|METCDS|NS1|PTP-1D|PTP2C|SH-PTP2|SH-PTP3|SHP2
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 72kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- IYMAVQHYIETLQRRIEEEQKSKRKGHEYTNIKYSLADQTSGDQSPLPPCTPTPPCAEMREDSARVYENVGLMQQQKSFR
- Uniprot:
- Q06124
- Synonyms:
- BPTP3;CFC;JMML;METCDS;NS1;protein-tyrosine phosphatase 1D;protein-tyrosine phosphatase 2C;PTP-1D;PTP2C;SH-PTP2;SH-PTP3;SH2 domain-containing protein tyrosine phosphatase 2;SHP2;tyrosine-protein phosphatase non-receptor type 11
- Extra Details:
- The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains two tandem Src homology-2 domains, which function as phospho-tyrosine binding domains and mediate the interaction of this PTP with its substrates. This PTP is widely expressed in most tissues and plays a regulatory role in various cell signaling events that are important for a diversity of cell functions, such as mitogenic activation, metabolic control, transcription regulation, and cell migration. Mutations in this gene are a cause of Noonan syndrome as well as acute myeloid leukemia.
- Shipping Conditions:
- Blue Ice