PE Rabbit anti-Mouse CD352/SLAMF6 monoclonal antibody

Size

POA

SKU:: A27924
Additional Names:: KAL1|KAL1b|Ly108|NTB-A|NTBA|SF2000
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: EVSQSSSDPQLMNGVLGESAVLPLKLPAGKIANIIIWNYEWEASQVTALVINLSNPESPQIMNTDVKKRLNITQSYSLQISNLTMADTGSYTAQITTKDSEVITFKYILRVFERLGNLETTNYTLLLENGTCQIHLACVLKNQSQTVSVEWQATGNISLGGPNVTIFWDPRNSGDQTYVCRAKNAVSNLSVSVSTQSLCKGVLTN
Uniprot:: Q9ET39
Synonyms:: activating NK receptor;CD352;KA;KAL;KAL1;KAL1b;KALI;KALIb;Ly10;Ly108;lymphocyte antigen 108;natural killer-, T- and B-cell antigen;NK-T-B-antigen;NTB;NTB-A;NTBA;NTBA receptor;SF200;SF2000;SLAM family member 6
Extra Details:: SLAMF6 (CD352/NTB-A) is a type I transmembrane glycoprotein belonging to the signaling lymphocyte activation molecule (SLAM) family of immunoregulatory receptors. Like other members of the SLAM receptor family, SLAMF6 possesses an extracellular region containing immunoglobulin (Ig)-like domains and an intracellular domain harboring conserved tyrosine-based signaling motifs. Upon phosphorylation, these motifs recruit the SAP (SLAM-associated protein) and EAT-2 adaptor signaling molecules. SLAMF6 is expressed on the surface of multiple immune cell lineages, including B cells, T cells, and natural killer (NK) cells. Its activation is triggered by homophilic interactions mediated through its extracellular domain. Functional studies demonstrate that SLAMF6 engagement in T cells promotes cellular activation and cytokine production. Similarly, ligand-induced homotypic binding of SLAMF6 in NK cells initiates signaling cascades that enhance proliferation, cytotoxic activity, and cytokine secretion.

Shipping Conditions:: Blue Ice