A27908
HDAC6 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A27908
- Additional Names:
- Hd6|Hdac5|mHDA2|Sfc6
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 140kDa
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MKMEDKEECSSSRLVIKKLPPTASPVSAKEMTTPKGKVPEESVRKTIAALPGKESTLGQAKSKMAKAVLAQGQSSEQAAKGTTLDLATSKETVGGATTDLWASAAAPENFPNQTTSVEALGETEPTPPASHTNKQTTGASPLQGVTAQQSLQLGVLSTLELSREAEEAHDSEEGLLGEAAGGQDMNSLMLTQGFGDFNTQDV
- Uniprot:
- Q9Z2V5
- Synonyms:
- CPBHM;HD6;Hdac5;histone deacetylase 5;histone deacetylase 6;histone deacetylase mHDA2;JM21;mHDA;mHDA2;PPP1R90;protein phosphatase 1, regulatory subunit 90;scurfy candidate 6;Sfc;Sfc6;tubulin-lysine deacetylase HDAC6
- Extra Details:
- Enables several functions, including cytoskeletal protein binding activity; protein lysine deacetylase activity; and ubiquitin binding activity. Involved in several processes, including positive regulation of type 2 mitophagy; protein destabilization; and tubulin deacetylation. Acts upstream of or within several processes, including aggresome assembly; neuron projection morphogenesis; and protein modification process. Located in several cellular components, including dendrite; microtubule cytoskeleton; and perikaryon. Part of cytoplasmic ubiquitin ligase complex. Is expressed in several structures, including central nervous system; early embryo; gut gland; lung; and metanephros. Human ortholog(s) of this gene implicated in chondrodysplasia with platyspondyly, distinctive brachydactyly, hydrocephaly, and microphthalmia and polycystic liver disease 1. Orthologous to human HDAC6 (histone deacetylase 6).
- Shipping Conditions:
- Blue Ice







