A27907
FOXO3A Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A27907
- Additional Names:
- 1110048B16Rik|2010203A17Rik|Fkhr2|FKHRL1|Foxo3a
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 82-97kDa
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAGTMNLNDGLAENLMDDLLDNIALPPSQPSPPGGLMQRGSSFPYTAKSSGLGSPTGSFNSTVFGPSSLNSLRQSPMQTIQENRPATFSSVSHYGNQTLQ
- Uniprot:
- Q9WVH4
- Synonyms:
- 1110048B16Rik;2010203A17Rik;AF6q21;C76856;FKHR;Fkhr2;FKHRL1;FKHRL1P2;forkhead box O3A;forkhead box protein O3;forkhead homolog (rhabdomyosarcoma) like 1;forkhead in rhabdomyosarcoma-like 1;forkhead protein FKHR2;forkhead, Drosophila, homolog of, in rhabdomyosarcoma-like 1;Fox;FOXO2;FOXO3A;FOXO3A-
- Extra Details:
- Enables DNA binding activity; DNA-binding transcription factor activity, RNA polymerase II-specific; and mitochondrial transcription factor activity. Involved in several processes, including mitochondrial transcription; positive regulation of muscle atrophy; and positive regulation of pri-miRNA transcription by RNA polymerase II. Acts upstream of or within several processes, including extrinsic apoptotic signaling pathway in absence of ligand; female gonad development; and neuronal stem cell population maintenance. Located in cytosol; mitochondrial outer membrane; and nucleus. Part of protein-containing complex. Colocalizes with mitochondrial matrix. Is expressed in several structures, including alimentary system; brain; early embryo; genitourinary system; and hemolymphoid system. Used to study dermoid cyst of ovary. Orthologous to human FOXO3 (forkhead box O3).
- Shipping Conditions:
- Blue Ice





