RIPK1/RIP Rabbit polyclonal antibody

Size

£152.00

SKU:: A27859
Additional Names:: AIEFL|IMD57|RIP|RIP-1|RIP1
Application:: ELISA, WB
Molecular Weight:: 78kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: NNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN
Uniprot:: Q13546
Synonyms:: AIEFL;cell death protein RIP;IMD57;receptor (TNFRSF)-interacting serine-threonine kinase 1;receptor-interacting protein 1;receptor-interacting protein kinase 1;receptor-interacting serine/threonine-protein kinase 1;RIP;RIP-1;RIP1;serine/threonine-protein kinase RIP
Extra Details:: This gene encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein plays a role in inflammation and cell death in response to tissue damage, pathogen recognition, and as part of developmental regulation. RIPK1/RIPK3 kinase-mediated necrosis is referred to as necroptosis. Genetic disruption of this gene in mice results in death shortly after birth.