DNAJC7 Rabbit polyclonal antibody

Size

£152.00

SKU:: A2780
Additional Names:: DJ11|DJC7|DNAJC7|TPR2|TTC2
Application:: ELISA, WB
Molecular Weight:: 60kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: VQFFVQALRMAPDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEHKQLLKNAQLELKKSKRK
Uniprot:: Q99615
Synonyms:: DJ11;DJC7;DnaJ (Hsp40) homolog, subfamily C, member 7;dnaJ homolog subfamily C member 7;tetratricopeptide repeat domain 2;tetratricopeptide repeat protein 2;TPR repeat protein 2;TPR2;TTC2
Extra Details:: This gene encodes a member of the DNAJ heat shock protein 40 family of proteins that is characterized by two N-terminal tetratricopeptide repeat domains and a C-terminal DNAJ domain. This protein binds the chaperone proteins heat shock proteins 70 and 90 in an ATP-dependent manner and may function as a co-chaperone. Pseudogenes of this gene are found on chromosomes 1 and 6. Alternate splicing results in multiple transcript variants.