[KO Validated] Abhd6 Rabbit monoclonal antibody

Size

POA

SKU:: A27794
Additional Names:: 0610041D24Rik|AA673485|ABHD6|AV065425
Application:: ELISA, WB, IHC-P, IF
Molecular Weight:: 38kda
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LSIVGQVKRIHQFVECLKLNKKPFHLIGTSMGGHVAGVYAAYYPSDVCSLSLVCPAGLQYSTDNPFVQRLKELEESAAIQKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHNSFYRKLFLEIVNEKSRYSLHENMDKIKVPTQIIWGKQDQVLDVSGADILAKSISNSQVEVLENCGHSVVMERPRK
Uniprot:: Q8R2Y0
Synonyms:: 0610041D24Rik;2-arachidonoylglycerol hydrolase;AA673485;abhydrolase domain-containing protein 6;AV065425;lipase protein;monoacylglycerol lipase ABHD6
Extra Details:: Enables monoacylglycerol lipase activity. Involved in acylglycerol catabolic process. Predicted to be located in late endosome membrane and lysosomal membrane. Predicted to be part of AMPA glutamate receptor complex. Predicted to be active in GABA-ergic synapse; glutamatergic synapse; and postsynaptic membrane.