PE Rabbit anti-Mouse CD152/CTLA-4 monoclonal antibody

Size

POA

SKU:: A27774
Additional Names:: Ctla4,Cd152,CTLA4
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD
Uniprot:: P09793
Synonyms:: ALPS5;CD;CD152;CD152 antigen;celiac disease 3;CELIAC3;Ctla;CTLA-4;cytotoxic T lymphocyte associated antigen 4 short spliced form;cytotoxic T-lymphocyte protein 4;cytotoxic T-lymphocyte-associated antigen 4;cytotoxic T-lymphocyte-associated serine esterase-4;GRD4;GSE;IDDM12;insulin-dependent diabetes mellitus 12;ligand and transmembrane spliced cytotoxic T lymphocyte associated antigen 4;Ly-5;Ly-56
Extra Details:: CD152, also known as CTLA-4 or Ly-56, is a 33 kDa member of the immunoglobulin superfamily. It is expressed on activated T and B lymphocytes. CD152 exhibits significant homology to CD28 in amino acid sequence, structural configuration, and genomic organization, with both receptors sharing ligands from the B7 family (B7-1 and B7-2). While CD28 delivers co-stimulatory signals during T cell activation, CTLA-4 functions as a critical negative regulator of cell-mediated immune responses. CD152 is implicated in the induction and maintenance of immune tolerance, the development of protective immunity, and the modulation of thymocyte homeostasis.

Shipping Conditions:: Blue Ice