[KD Validated] NOX1 Rabbit monoclonal antibody

Size

POA

SKU:: A27773
Additional Names:: GP91-2|MOX1|NOH-1|NOH-1L|NOH1
Application:: ELISA, WB
Molecular Weight:: 65kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: RKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILYICERILRFYRSQQKVVITKVVMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPF
Uniprot:: Q9Y5S8
Synonyms:: GP91-2;mitogenic oxidase (pyridine nucleotide-dependent superoxide-generating);mitogenic oxidase 1;MOX1;NADH/NADPH mitogenic oxidase subunit P65-MOX;NADPH oxidase 1;NADPH oxidase homolog-1;NOH-1;NOH1
Extra Details:: This gene encodes a member of the NADPH oxidase family of enzymes responsible for the catalytic one-electron transfer of oxygen to generate superoxide or hydrogen peroxide. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.