A27768
HLA Class 1 ABC Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A27768
- Additional Names:
- AS|B-4901|HLAB
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 40-50 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRE
- Uniprot:
- P01889, P04439, P10321
- Synonyms:
- AS;B-4901;D6S204;HLA class I antigen HLA-B;HLA class I histocompatibility antigen, A alpha chain;HLA class I histocompatibility antigen, A-1 alpha chain;HLA class I histocompatibility antigen, B alpha chain;HLA class I histocompatibility antigen, C alpha chain;HLA-C antigen;HLA-JY3;HLAA;HLAB;HLAC;HLC-C;Human leukocyte antigen B;human leukocyte antigen-C alpha chain;leukocyte antigen class I-A;leukocyte antigen class I-B;major histocompatibility antigen HLA-C;major histocompatibility complex, class I, B;MHC;MHC class 1 antigen;MHC class I antigen A*3;MHC class I antigen B*7;MHC class I antigen Cw*7;MHC class I antigen heavy chain HLA-C;MHC class I antigen HLA-A heavy chain;MHC class I antigen HLA-B alpha chain;MHC class I antigen HLA-B heavy chain;MHC class I antigen SHCHA;MHC class I molecule;MHC HLA-B cell surface glycoprotein;MHC HLA-B transmembrane glycoprotein;PSORS1
- Extra Details:
- HLA-B belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. Class I molecules play a central role in the immune system by presenting peptides derived from the endoplasmic reticulum lumen. They are expressed in nearly all cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon 1 encodes the leader peptide, exon 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region and exons 6 and 7 encode the cytoplasmic tail. Polymorphisms within exon 2 and exon 3 are responsible for the peptide binding specificity of each class one molecule. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. Hundreds of HLA-B alleles have been described.
- Shipping Conditions:
- Blue Ice







