A27764
MMP3 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A27764
- Additional Names:
- CHDS6|MMP-3|SL-1|STMY|STMY1|STR1
- Application:
- ELISA, WB
- Molecular Weight:
- 54kDa
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- VKKIDAAISNKEKRKTYFFVEDKYWRFDEKKQSMEPGFPRKIAEDFPGVDSRVDAVFEAFGFLYFFSGSSQLEFDPNAKKVTHILKSNSWFNC
- Uniprot:
- P28862
- Synonyms:
- CHDS6;EMS-2;matrix metalloproteinase 3;matrix metalloproteinase 3 (stromelysin 1, progelatinase);Matrix metalloproteinase-3;MMP-3;progelatinase;proteoglycanase;S;SL;SL-1;SLN-1;SLN1;St;STMY;STMY1;STR;STR-1;STR1;stromelysin-1;transin-1
- Extra Details:
- Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This gene encodes an enzyme which degrades fibronectin, laminin, collagens III, IV, IX, and X, and cartilage proteoglycans. The enzyme is thought to be involved in wound repair, progression of atherosclerosis, and tumor initiation. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3.
- Shipping Conditions:
- Blue Ice

