A27760
IRF3 Rabbit polyclonal antibody
Size
POA
- SKU:
- A27760
- Additional Names:
- IIAE7
- Application:
- ELISA, WB
- Molecular Weight:
- 55kDa
- Species Reactivity:
- Porcine
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Species:
- Porcine
- Sequence:
- MGTQKPRILPWLISQLNQGQLEGVAWLDEGHTRFRIPWKHGLRQDAQQEDFGIFQAWAEASGAYTPGKDKPDLPTWKRNFRSALNRKEALRLAEDHSKDP
- Uniprot:
- Q764M6
- Synonyms:
- IIAE7;interferon regulatory factor 3;IRF-3
- Extra Details:
- This gene encodes a member of the interferon regulatory transcription factor (IRF) family. The encoded protein is found in an inactive cytoplasmic form that upon serine/threonine phosphorylation forms a complex with CREBBP. This complex translocates to the nucleus and activates the transcription of interferons alpha and beta, as well as other interferon-induced genes. The protein plays an important role in the innate immune response against DNA and RNA viruses. Mutations in this gene are associated with Encephalopathy, acute, infection-induced, herpes-specific, 7.
- Shipping Conditions:
- Blue Ice