DLST Rabbit monoclonal antibody

Size

POA

SKU:: A27738
Additional Names:: DLTS|KGD2|PGL7
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 55kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: PAKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPLAEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTT
Uniprot:: P36957
Synonyms:: 2-oxoglutarate dehydrogenase complex component E2;dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex);Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex;dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial;DLTS;E2K;KGD2;OGDC-E2;PGL7
Extra Details:: This gene encodes a mitochondrial protein that belongs to the 2-oxoacid dehydrogenase family. This protein is one of the three components (the E2 component) of the 2-oxoglutarate dehydrogenase complex that catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). Alternatively spliced transcript variants have been found for this gene.