APC Rabbit anti-Mouse TNF-A Alpha monoclonal antibody

Size

POA

SKU:: A27728
Additional Names:: DIF|TNF-a|TNF-alpha|Tnfa|TNFalpha|Tnfsf1a|TNFSF2|Tnlg1f
Application:: Flow Cytometry
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
Uniprot:: P06804
Synonyms:: APC1 protein;cachectin;DI;DIF;Tn;TNF-;TNF-a;TNF-alpha;TNF, macrophage-derived;TNF, monocyte-derived;TNFA;TNFalpha;Tnfs;Tnfsf1a;TNFSF2;TNLG1F;tumor necrosis factor;tumor necrosis factor ligand 1F;tumor necrosis factor ligand superfamily member 2;tumor necrosis factor-alpha
Extra Details:: This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. Members of this family are classified based on primary sequence, function, and structure. This protein is synthesized as a type-II transmembrane protein and is reported to be cleaved into products that exert distinct biological functions. It plays an important role in the innate immune response as well as regulating homeostasis but is also implicated in diseases of chronic inflammation. In mouse deficiency of this gene is associated with defects in response to bacterial infection, with defects in forming organized follicular dendritic cell networks and germinal centers, and with a lack of primary B cell follicles. Alternative splicing results in multiple transcript variants.

Shipping Conditions:: Blue Ice