Heme Oxygenase 1 Rabbit monoclonal antibody

Size

POA

SKU:: A27713
Additional Names:: D8Wsu38e|Hemox|Hmox|HO-1|HO1|Hsp32
Application:: ELISA, WB, IHC-P, IF
Molecular Weight:: 28 kDa/33 kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ERPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRPASLVQDTAPAETPRGKPQISTSSSQT
Uniprot:: P14901
Synonyms:: bK286B10;D8Wsu38;D8Wsu38e;heat shock protein, 32-kD;heme oxygenase (decycling) 1;heme oxygenase 1;Hemox;hemoxygenase;Hmo;Hmox;HMOX1D;HO;HO-;HO-1;HO1;Hsp;HSP32;P32 protein
Extra Details:: Predicted to enable several functions, including heme binding activity; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen; and protein homodimerization activity. Acts upstream of or within several processes, including cellular response to cadmium ion; cellular response to cisplatin; and regulation of macroautophagy. Located in nucleus. Is active in cytosol. Is expressed in several structures, including alimentary system; central nervous system; genitourinary system; respiratory system; and sensory organ. Used to study hemochromatosis and malaria. Human ortholog(s) of this gene implicated in several diseases, including artery disease (multiple); cerebrovascular disease (multiple); factor VIII deficiency; lung disease (multiple); and sickle cell anemia. Orthologous to human HMOX1 (heme oxygenase 1).

Shipping Conditions:: Blue Ice