Acetyl-Histone H3-K27 Rabbit monoclonal antibody

Size

POA

SKU:: A2771
Application:: ChIP, ELISA, WB, IHC-P, IF, ICC, IP, Dot blot
Molecular Weight:: 17kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Acetyl K27
Sequence:: MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
Uniprot:: P68431, Q16695
Synonyms:: H3 histone family, member A;H3 histone family, member B;H3 histone family, member C;H3 histone family, member D;H3 histone family, member F;H3 histone family, member H;H3 histone family, member I;H3 histone family, member J;H3 histone family, member K;H3 histone family, member L;H3 histone family, member T;H3.1;H3.4;H3.f;H3/A;H3/b;H3/c;H3/d;H3/f;H3/g;H3/h;H3/i;H3/j;H3/k;H3/l;H3/t;H3C1;H3C10;H3C11;H3C12;H3C2;H3C3;H3C4;H3C6;H3C7;H3C8;H3F1K;H3FA;H3FB;H3FC;H3FD;H3FF;H3FH;H3FI;H3FJ;H3FK;H3FL;H3FT;H3t;HIST1H3A;HIST1H3B;HIST1H3C;HIST1H3D;HIST1H3E;HIST1H3F;HIST1H3G;HIST1H3H;HIST1H3I;HIST1H3J;HIST3H3;histone 1, H3a;histone 1, H3b;histone 1, H3c;histone 1, H3d;histone 1, H3e;histone 1, H3f;histone 1, H3g;histone 1, H3h;histone 1, H3i;histone 1, H3j;histone 3, H3;histone cluster 1 H3 family member a;histone cluster 1 H3 family member b;histone cluster 1 H3 family member c;histone cluster 1 H3 family member d;histone cluster 1 H3 family member e;histone cluster 1 H3 family member f;histone cluster 1 H3 family member g;histone cluster 1 H3 family member h;histone cluster 1 H3 family member i;histone cluster 1 H3 family member j;histone cluster 1, H3a;histone cluster 1, H3b;histone cluster 1, H3c;histone cluster 1, H3d;histone cluster 1, H3e;histone cluster 1, H3f;histone cluster 1, H3g;histone cluster 1, H3h;histone cluster 1, H3i;histone cluster 1, H3j;histone cluster 3 H3;histone H3.1;histone H3.1t;histone H3.4;histone H3/a;histone H3/b;histone H3/c;histone H3/d;histone H3/f;histone H3/h;histone H3/i;histone H3/j;histone H3/k;histone H3/l
Extra Details:: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Shipping Conditions:: Blue Ice