Synaptophysin Rabbit monoclonal antibody

Size

POA

SKU:: A27659
Additional Names:: MRX96|SYN|SYP
Application:: ELISA, WB, IHC-P, IF, IP
Molecular Weight:: 38 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: KETGWAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM
Uniprot:: P08247
Synonyms:: major synaptic vesicle protein P38;MRX96;MRXSYP;synaptophysin;XLID96
Extra Details:: Synaptophysin (SYP, also known as major synaptic vesicle protein p38) is a 38-kDa integral membrane glycoprotein that regulates synaptic vesicle endocytosis. It is the most abundant synaptic vesicle protein by mass. Synaptophysin is present in neuroendocrine cells and neurons that participate in synaptic transmission. Synaptophysin is a useful marker for the identification of neuroendocrine cells and neoplasms. Synaptic proteins including synaptophysin are reduced in brain tissue from patients with Alzheimer's disease.(PMID: 3010302; 21658579)