12 Lipoxygenase/ALOX12 Rabbit monoclonal antibody

Size

POA

SKU:: A27652
Additional Names:: 12-LOX|12S-LOX|LOG12
Application:: ELISA, WB, IF
Molecular Weight:: 76kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: YQRDDIVKGDPELQAWCREITEVGLCQAQDRGFPVSFQSQSQLCHFLTMCVFTCTAQHAAINQGQLDWYAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYEYLKPSCIENSVTI
Uniprot:: P18054
Synonyms:: 12-LOX;12S-lipoxygenase;12S-LOX;arachidonate (12S)-lipoxygenase;arachidonate (15S)-lipoxygenase;Arachidonate 12-lipoxygenase, 12S-type;arachidonate 15-lipoxygenase,15S-type;linoleate 13S-lipoxygenase;lipoxin synthase 12-LO;LOG12;platelet 12-LOX;platelet-type 12-lipoxygenase;platelet-type lipoxygenase 12;polyunsaturated fatty acid lipoxygenase ALOX12
Extra Details:: This gene encodes a member of the lipoxygenase family of proteins. The encoded enzyme acts on different polyunsaturated fatty acid substrates to generate bioactive lipid mediators including eicosanoids and lipoxins. The encoded enzyme and its reaction products have been shown to regulate platelet function. Elevated expression of this gene has been observed in pancreatic islets derived from human diabetes patients. Allelic variants in this gene may be associated with susceptibility to toxoplasmosis. Multiple pseudogenes of this gene have been identified in the human genome.

Shipping Conditions:: Blue Ice