ABflo[R] 488 Rabbit anti-Human CD63 monoclonal antibody

Size

POA

SKU:: A27603
Additional Names:: LAMP-3|ME491|MLA1|OMA81H|TSPAN30
Application:: Flow Cytometry
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM
Uniprot:: P08962
Synonyms:: CD63 antigen;CD63 antigen (melanoma 1 antigen);granulophysin;LAMP-3;lysosomal-associated membrane protein 3;lysosome-associated membrane glycoprotein 3;ME491;melanoma-associated antigen ME491;melanoma-associated antigen MLA1;MLA1;ocular melanoma-associated antigen;OMA81H;tetraspanin-30;tspan-30;TSPAN30
Extra Details:: The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The encoded protein is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker. Deficiency of this protein is associated with Hermansky-Pudlak syndrome. Also this gene has been associated with tumor progression. Alternative splicing results in multiple transcript variants encoding different protein isoforms.

Shipping Conditions:: Blue Ice